peptide mimetics |
peptide-morpholinos |
T stem cell memory cells |
||
[peptide, peptides, Peptide Sequences MiniCOPE dictionary, peptide sequences, peptide sequence, peptide fragment, peptide fragments]
This is one of several topic-specific MiniCOPE Dictionaries within COPE. This subdictionary is a computerized list of all peptide sequences for which there are entries in COPE.
• AACSDRAHGHICESFKSFCKDSGRNGVKLRANCKKTCGLC
• AAHLPAEFTTPAVHASLDKFLSNVSTVLTSKYR
•
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |